McDonnell Genome Institute

Washington University

CircRNA

chr14|99257470|99257839|-|BCL11B|ENST00000345514.2

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

HPPHAPSSGK

Amino Acids from 5' Exons

QRLTMWRPPSSKKTRVWRRSQVAWGWWVAPTLTCSPVASVKTSPWGTSWFLSTKGSSVAAAWVPAMTRPWTRTARHPPHAPSSGKCPSRWRSGSKSPPTKMTTCSHPRKASVPSRRTLQ,RGPCGGRHPRRRRGSGDRGAKWPGADGGWPRPPAHLWPVSNELPLGGHPGFYRAQKEAVWRQLGCLLQGPGQGQPATLLTLRAQESVRAGGDRDPSHPRRRPPALTHERHLSQAGEHC,EADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQCQMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTPDEDDHLLSPTKGICPKQENIA

Amino Acids from 3' Exons

QRLTMWRPPSSKKTRVWRRSQVAWGWWVAPTLTCSPVASVKTSPWGTSWFLSTKGSSVAAAWVPAMTRPWTRTARHPPHAPSSGKCPSRWRSGSKSPPTKMTTCSHPRKASVPSRRTLQ,RGPCGGRHPRRRRGSGDRGAKWPGADGGWPRPPAHLWPVSNELPLGGHPGFYRAQKEAVWRQLGCLLQGPGQGQPATLLTLRAQESVRAGGDRDPSHPRRRPPALTHERHLSQAGEHC,EADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQCQMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTPDEDDHLLSPTKGICPKQENIA