McDonnell Genome Institute

Washington University

CircRNA

chr14|95455376|95457338|-|SYNE3|ENST00000334258.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9811

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

AGTEDELVAHWRRYSK

Amino Acids from 5' Exons

DIAKDFPRGEESLETLEEQSAGVIRNTSPLGAEKITGELEEMRKVLEKLRALWEEEEERLRGLLRSRGAWEQQIKQLEAELSEFRMVLQRLAQEGLQPAAKAGTEDELVAHWRRYS,TLPKIFPGARSLWRRWRSSLRVSFGTPLLWVQRRSPENWKRGKFWRSCAPSGRRRRSGCGACSGPGEPGSSRLSSWRLSSVSSGWSCRGWPRRACSLRRKRGPRTSWWHTGDAT,HCQRFSQGRGVSGDAGGAVCGCHSEHLSFGCREDHRRTGRDEESSGEAARPLGGGGGAAAGPAPVQGSLGAADAAGGAQVQDGPAEAGPGGPAACGESGDRGRAGGTLETLL

Amino Acids from 3' Exons

KRVDLLEQVAREHEEYQAGVDEFQLWLKAVVEKVNGCLGRNCKLPITQRLSTLQ,SVICWSRWPGSMRSTRQVWTSSNCGRRWWRRMAAWGGTASCPSRSASPHC,ACRSAGAGGPGAGVPGRCGRVPTVAEGGGGEGEWLPGAELQAAHHAAPLHTA