McDonnell Genome Institute

Washington University

CircRNA

chr14|93947348|93953507|-|ASB2|ENST00000315988.8

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

LLGNVQGPPGLSPVTAPSR

Amino Acids from 5' Exons

VLTSTRRPATTRLPSTRPARMSMRRWWSFCCHRVPTPTRPTRTACSRCTSPPRRATT,CHQHAGQRQRVCPLRGLQEAGGGGVSAVTGCRRQQDQQGRLAPAAHRLQEGQLQ,ADINTQASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKGNY

Amino Acids from 3' Exons

RTQGPSTSAPCRRKQPFTWQRAGATWTVSCHCSKQGQSRTSPTNPERHRSTK,VPRDHRPAHPAGGNSRLLGNVQGPPGLSPVTAPSRGRAGHLQQIPRDTALQ,YPGTIDQRTLQEETAVYLATCRGHLDCLLSLLQAGAEPDISNKSRETPLYK