McDonnell Genome Institute

Washington University

CircRNA

chr14|93487662|93497286|+|UNC79|ENST00000256339.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9929

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

GLQYTVGSSR

Amino Acids from 5' Exons

WAPQGEKVYLPMLTSLHHPCLQCSTHPIQ,GLLKERRCTCPCPLCIIHANDCNAVHIQS,GSSRREGVPAHVNLSASSMLMIAMQYTSNP

Amino Acids from 3' Exons

DLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGLQYT,IFCMLRMGLHKSLQLCKCFSTTGPINLLGQASTGGCSTQ,SFVCDCVWAFTSEASSCANAFPLLAQFKTSWGNKRVQGVAVH