McDonnell Genome Institute

Washington University

CircRNA

chr14|93219211|93222374|+|UBR7|ENST00000013070.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9615

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

RFADEGTTVFK

Amino Acids from 5' Exons

TVFKNESLNAESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCM,QCLRMKASTQNQNLAANFRSLKLSSLRKTLPPIGPTGVASCVPAKTV,SVEKPQRRIKIWLQTSGASAAYKERHCHLLAPELAQVVYLPRLY

Amino Acids from 3' Exons

NTMIRLNLKTISRDLLMKA,IQFEDTRLSQEICRH,YNDLKTELKDYLKRFADEGT