McDonnell Genome Institute

Washington University

CircRNA

chr14|92946330|92946493|-|ITPK1|ENST00000267615.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9351

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

GHPGALPGPAAGTGR

Amino Acids from 5' Exons

LDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFP,WTRSRACSSGRATRSSGSSPGPCGRHWACHSSASTSSSTTRQGSTPSLTSMPSQ,GQDRGRVRAAERRGHPGALPGPAAGTGRVTLRHRHHHQQPDRAARRHHQCLP

Amino Acids from 3' Exons

LDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFP,WTRSRACSSGRATRSSGSSPGPCGRHWACHSSASTSSSTTRQGSTPSLTSMPSQ,GQDRGRVRAAERRGHPGALPGPAAGTGRVTLRHRHHHQQPDRAARRHHQCLP