McDonnell Genome Institute

Washington University

CircRNA

chr14|92142163|92143294|+|CPSF2|ENST00000298875.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9347

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

ITEIEQMSWK

Amino Acids from 5' Exons

QMSWKHFEVMEMCQWTQQAEFWNLLNFLIRFGGLKMQDWVFTHWHSIMSVTMWWSFLSP,KCPGNTSRWKCVNSSGHSRQSFGTCSTSSDLEDRCRIGCLLIGTPKCQLQCGGVFVP,NVLETLRGDGNVLIAVDTAGRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFSKSQ

Amino Acids from 3' Exons

VEWMSDKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPKNSIILTYRTTPGTLARFLIDNPSEKITEIE,NGVINDVLKTKEIIRFSFAISLYVMVFLTWPVYLALKLYLPANLTWNADFQGISLFSGVRTLKTQSFPTELLLGLHVSLIILLKKLQK,RMDEIDEMFRQKKSVSVSPSLFMSWSFLGPCTPSCTCQPTPGMRIFKGSLYSVVSGPKLNHSNLQNYSWDFSTFPNSFKNYRNR