McDonnell Genome Institute

Washington University

CircRNA

chr14|92082299|92093831|-|ATXN3|ENST00000340660.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9216

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

AIQLSMQGYK

Amino Acids from 5' Exons

SPNRPGTSVRSKWLRNVRRRGGFAEGSGTKSPRNHGRGSRSPQGYSAKYA,VHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQ,SIKQTWNECKQMMAQECTKMRRICRGLWHVAKKLTWKMRKQISAGLFSVCK

Amino Acids from 3' Exons

VISNALKVWGLELILFNSPEYQRLRIDP,LAMPKFGVNSCSTVQSIRGSGSIL,YKQCLESLGFRTNPVQQSRVSEAQDRSY