McDonnell Genome Institute

Washington University

CircRNA

chr14|92014214|92014577|-|TRIP11|ENST00000267622.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9766

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

11

Peptide

LQQALSGGSGVIETDLSK

Amino Acids from 5' Exons

VALELKLISLKSMRCKKLFKFYKKKWSLPKKWNNLRIKKIIKNYLLQKMTEIFGENKNSMWKRDKWKNVKTNWNVVNCSLLLSKVILQKRKEFLPRVHQWKKCSDYNKHCL,WLWSYRNSLNLDAKNYSSSTNRKSGVYQKNGTTGNKRYKKIIFCRKQRYFEERTRTAKCGKETNNGRMKLEIGMIAAFCCEAKYYDRKGKNSCPECISGRSVQTTTSTV,GSGVIETDLSKIYEMQKTIQVLQIEKVESTKKMEQLEDKIKDINKKLSSAENDRDILRREQEQLNVEKRQIMEECENLKLECSKLQPSAVKQSDTMTEKERILAQSASVEEVFRLQQALS

Amino Acids from 3' Exons

VALELKLISLKSMRCKKLFKFYKKKWSLPKKWNNLRIKKIIKNYLLQKMTEIFGENKNSMWKRDKWKNVKTNWNVVNCSLLLSKVILQKRKEFLPRVHQWKKCSDYNKHCL,WLWSYRNSLNLDAKNYSSSTNRKSGVYQKNGTTGNKRYKKIIFCRKQRYFEERTRTAKCGKETNNGRMKLEIGMIAAFCCEAKYYDRKGKNSCPECISGRSVQTTTSTV,GSGVIETDLSKIYEMQKTIQVLQIEKVESTKKMEQLEDKIKDINKKLSSAENDRDILRREQEQLNVEKRQIMEECENLKLECSKLQPSAVKQSDTMTEKERILAQSASVEEVFRLQQALS