McDonnell Genome Institute

Washington University

CircRNA

chr14|91877486|91881418|-|FBLN5|ENST00000267620.14

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9936

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

TSTNVSTGTTR

Amino Acids from 5' Exons

PLYVSCEPWLQRPALYHLVPGHGRGVRTLRSRHLPNASHDPLPWGLLHFPDQIWEGQRILHA,RCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMR,AVCVLLRTLAAETSPLPSCTGTWTWCQDAPFPLTSSKCKPRPATLGPITFSRSNLGMRAENFTC

Amino Acids from 3' Exons

TSTNVSTGTTRATCSRRATIYKGASNALTPSAVRSLIGSVI,HQRMAQEPHVQPAADVLQFTRGLQMHPHPLGALSEDQ,INECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISD