McDonnell Genome Institute

Washington University

CircRNA

chr14|91785161|91802421|-|TC2N|ENST00000340892.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

11

Peptide

HFVGQDLPEHLLEIER

Amino Acids from 5' Exons

VFSRWECLARESFIRKRHAYRPPMEESSGERLFFHLYRVKKKLFFSLSFTVEALEENTLWA,FFREGGNVLGRVDLEKDTLTEGLQWKSQVGRDYDFSTYTEKRNCFSHALQSKLCKKKTLCGP,FFVKVGMFSSGELIYKKKTRLLKASNGRVKWGETMIFPLIQSEKEIVFLIKLYSRSSVRRKHFVGQ

Amino Acids from 3' Exons

DLPEHLLEIERNFPVHPSTDLAMMCITHSICISTFHLIVDAFLPVQKRDCMDR,ICQSIFWRSKGRTFQFIPARTLCVPILYVSAHFTFESTLSSPFRSEETVWI,SARASFGDRKVELSSSSQHGPSYDVYNPFYMYQHISPDLSRRFPPRSEVKRLYGS