McDonnell Genome Institute

Washington University

CircRNA

chr14|91313079|91324923|-|CCDC88C|ENST00000389857.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9534

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

EDRDTDKK

Amino Acids from 5' Exons

IKDLEQEKDHLNRAMWSLRERSQVSSEARMKDVEKENKALHQTVTEANGKLSQLEFEKRQLHRDLEQAKEKGERAEKLERELQRLQEENGRLARKVTSLETATEKVEALEHESQGLQLENRTLRKSLDTLQNVSLQLEGLERDNKQLDAENLELRRLVETMRFTSTKLAQMERENQQLEREKEELRKNVDLLKALGKKSERLELSYQSVSAENLRLQQSLESSSHKTQTLESELGELEAERQALRRDLEALRLANAQLEGAEKDRKALEQEVAQLEKDKKLLEKEAKRLWQQVELKDAVLDDSTAKLSAVEKESRALDKELARCRDAAGKLKELEKDNRDLTKQVTVHARTLTTLRE,SRTLSRKRTTSTEPCGRCGRGRRSAVRPAKTWRRRTKPSTRRRRPMASSASWSLRSGSCTGTWSRPRRRGSGQRSWRGSYSDSRRRTGGWPGRPPWRQPPRKSRPWSMRARACSWRTGLGSLWTPCRTCPCSLRAWSVTTSSWTQRTWSCAGWWRPCASPAPSWHRWRGRTSSWSVRRRSGRTWICSRRWARSQSAWSSATRAALRTSGCSRAWRAAATRRRPWRVSWASWRLSARRCGGTWRPSGWPMHSWRGPRRTGRPWSRRWPSSRRIRSCWRRRPSGCGSRWSSRMQSWTIALPNCPPLRRRAARWTRSWPAAGTQPASRSWRRTTGTSPSKSPCMQGHQLG,QGPAGKGPPQPSHVVAAGEVAGQQGPHERRGEGEQSPPPDGDGGQWQAQPVGVEAAAAQGLGAGQGEGGAGREAGEGATATPGGEREAGQEGDLPGDSHRESRGPGAEPGPAAGEPDSEEVSGHLAERVPAAGPGAQQAAGRREPGAAQAGGDHALHQHQAGTDGEGEPAAGAEGGAEEERGSAQGAGQEVRAPGAQLPEREREPPAAAEPGEQQPQDADLGEAGRAGGAPGAAAGPGGPPAGQCTVGGGREGQEGPGAGGGPAREGEAAGEGGQAAVAAGGAQGCSLGRHCQTVRREGEPRAGQGAGPLQGRSRQAEGAGEGQPGPHQASHRACKDTDNSEG

Amino Acids from 3' Exons

DRDTDKKRIEELLEENMVLEIAQKQSMNESAHLGWELEQLSKNADLSD,TGTQIRNELRSCWKKTWSLRLHRSRATNLPTLAGSWSSCPRTQTCQT,PGHRETNGAAGRKHGPDCTEAEHERICPPWLGAGAAVQERRLVR