McDonnell Genome Institute

Washington University

CircRNA

chr14|91277921|91283517|-|CCDC88C|ENST00000331194.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9179

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

SSPTHALGI

Amino Acids from 5' Exons

APPSSSMAGLRASAAKTSPAGTWPLCPGKPAHRDATPSAATSTPCLGTGLSHRRVPRRGAQPLPTSECGPARPPPAVRWSPWRSSWRRATAAPPP,LLRAAPWPVELQQRRPDPQQGPGHFAPGSQHTGTQRPRPPRVPLASERASPTGGCPEEGHSPSLRRSAALLGLPQQDGHLGGVPGGEQPQLPHP,SSEQLHGRSESFSSEDLIPSRDLATLPREASTPGRNALGRHEYPLPRNGPLPQEGAQKRGTAPPYVGVRPCSASPSSEMVTLEEFLEESNRSSPTH

Amino Acids from 3' Exons

ALGINQSEAPHTEAALTAQMPPPIWPGPGPRSWAPGLAQLQPPLQPLPTPPPSPGTQAAPK,PWGSKTKARLPTQRQPPHRCLHRSGHEVLALGAGLPDLLNFSHHYSPFQLHPHRPAPRPHQ,PGDLKPKRGSPHRGSLDRTDASTDLAMRSWPSELGSRTCSTSATTTAPSNSTPIARHPGRTK