McDonnell Genome Institute

Washington University

CircRNA

chr14|91173288|91176056|+|C14orf159|ENST00000520328.5

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9265

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

AGAGLLLPR

Amino Acids from 5' Exons

TTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLG,QQCLVLPMLASAALWWSRGPFPRTSWKGWCGPAAPSE,NSALCYPCWLLLPSGGHDEAHSQGQAGRAGAGLLLPR

Amino Acids from 3' Exons

NCWESKSFPNLPTGMPWCVPQGRFQCSGLLRPVSELSAAV,TVGNQRAFQTCLRGCHGVSPRGGSSVLAFSADQSRSCQQL,LLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSC