McDonnell Genome Institute

Washington University

CircRNA

chr14|91170002|91173439|+|C14orf159|ENST00000256324.14

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

97

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

RDPAGHSQAGAYK

Amino Acids from 5' Exons

DGPSPVLEIRVRCLHRQPGFAGAVLGAAEGHGGLLPGLQLLPGGGLGESGAPQKRPSRSQPGGCIQ,MGHPQFWKYEFGACTGSLASLEQYSEQLKDMVAFFLGCSFSLEEALEKAGLPRRDPAGHSQAGAYK,WAIPSSGNTSSVPAPAAWLRWSSTRSSRTWWPSSWAAASPWRRPWRKRGSPEETQQVTARRVHT

Amino Acids from 3' Exons

TTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDP,QQCLVLPMLASAALWWSRGPFPRTSWKGWCGPAAPSEVSRGNLFTWATQ,NSALCYPCWLLLPSGGHDEAHSQGQAGRAGAGLLLPRRAGATCSHGRP