McDonnell Genome Institute

Washington University

CircRNA

chr14|91157638|91181389|+|C14orf159|ENST00000256324.14

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.912

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

ELESMIGIDPGAK

Amino Acids from 5' Exons

EPSYTLFNPAFKGTTL,SQVTPCLTLPSKGRLCK,AKLHPVPCLQRDDSV

Amino Acids from 3' Exons

RPHWLLPASQAAQLLTRMQRLHLVVSPQREFQRSITFPKILCTTASRQSLLLRRSENSLSATQ,DPTGFCQHPRLHSYDPEGCKGSTWLSHPRENSRGPSHFPRSSALQHRVSLCFSEDQRTRVYDRHRP,TPLAFASIPGCTVMTDLKDAKAPPGCLTPERIPEVHHISQDPLHYSIASVSASQKIRELESMIGIDP