McDonnell Genome Institute

Washington University

CircRNA

chr14|89980539|89985210|+|TDP1|ENST00000554976.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9407

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

IIGDILDLRRK

Amino Acids from 5' Exons

ENDAAALRRPPGCHTHLQPHPCLAPENSRVRRGLLTSWQCVC,KMMLLLYEEGLRVVIHTSNLIHADWHQKTQGFVGACSLPGSVCVDK,KCCCSMKKASGLSYTPPTSSMLTGTRKLKGSGPAHFLAVCVLIK

Amino Acids from 3' Exons

CLSYWFNPRTLSRKSKRLGTFTE,VYLIGSTPGRFQGSQKDNWGHFRLKK,FILLVQPQDAFKEVKKIIGDILDLR