McDonnell Genome Institute

Washington University

CircRNA

chr14|77557040|77570508|-|SPTLC2|ENST00000216484.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9776

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

PLFMVSLGHEGPGR

Amino Acids from 5' Exons

ICKARSYKMPLFMVSLGHEGPGRKFSSLWKEYI,YAKPREAIERCHCLWSASDTKALEENSHPCGRNI,MQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIY

Amino Acids from 3' Exons

ETWTSMKNRSLQGSEKLLWRMAWDLQRIQTFLLLLA,KPGQARTRGACSKVLRSRSCYGVWHGICNEFNEHSCSCWQ,NLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGK