McDonnell Genome Institute

Washington University

CircRNA

chr14|77552095|77597380|-|SPTLC2|ENST00000216484.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

12

Peptide

APALIHHVTQNGGLYK

Amino Acids from 5' Exons

ELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSL,STTCEHILIVQCMPRHCHLLWSRSSPPSASWGRMAPAL,ADRLPANTFSCSVCHVIVTSCSGADHHLHEVHHGAGWHQP

Amino Acids from 3' Exons

IHHVTQNGGLYKRPFNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQK,SIMLHKMEDYIKDRLMKLLKKHQCWLLCSRMWGMAYSPSLDIFEISGIGELKSVTMQQKEKNK,PSCYTKWRTIKTVSFRNTNAGCCAHVCGVWRTHPLWISSRFLEVLENKVSPCNRKRRTK