McDonnell Genome Institute

Washington University

CircRNA

chr14|77552095|77557146|-|SPTLC2|ENST00000216484.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9837

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

6

Peptide

CIMGQDGTSLDMQSLEK

Amino Acids from 5' Exons

ELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSL,STTCEHILIVQCMPRHCHLLWSRSSPPSASWGRMAPAL,ADRLPANTFSCSVCHVIVTSCSGADHHLHEVHHGAGWHQP

Amino Acids from 3' Exons

ICKARSYKMPLFMVSLGHEGPGRKFSSLWKEYI,YAKPREAIERCHCLWSASDTKALEENSHPCGRNI,MQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIY