McDonnell Genome Institute

Washington University

CircRNA

chr14|75109684|75114313|-|NEK9|ENST00000238616.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9816

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

ELYTWVNPLNLCVK

Amino Acids from 5' Exons

VKHCDSTHCCSNITNQSLCLGWWKIHPPETGCYQEWLCPAGLCREYPLCCGHSGEGTVHLG,SSTVTEAPIAVVTSRTSEVYVWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWV,QALLKHPLLHHEPVKSMFGVVENPPPRNWMLSRVAVVPGRSVQGIPTLLWSQWRRNCTLG

Amino Acids from 3' Exons

NPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQ,THLTCVRSCKEFGPWKLTLASTLWNSKWFIRALT,PTPVCEDRARNSGHGSLPVLFGIDPNGSFVPP