McDonnell Genome Institute

Washington University

CircRNA

chr14|75087017|75124223|-|NEK9|ENST00000238616.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9879

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

LEGGQQDDSLVVWK

Amino Acids from 5' Exons

SPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQ,HLGILQPVLGREHHLLLRVRAALCRWRLRDCRVWCSVWLNNRSYSKKTSRFLPNCRSTRNKEGS,TSAESCSNLCWEGNTTDSSCVCVQLSAGGGEIAGSGVKVSGTTEATARKPPDFYPTAEVEQEIRRRAA

Amino Acids from 3' Exons

DDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCN,MTHWLCGRKSIPGCLRRNVVMPMRLLFWHCCSTTTLLPTTITSWTIPRCLSWNIVM,LTGCVEGSRFDPAVEGTSCLEDCYSGTAAARQHYCLLQSLHGQYHAADAGIL