McDonnell Genome Institute

Washington University

CircRNA

chr14|74816202|74817107|+|YLPM1|ENST00000325680.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

GFEIVVIMR

Amino Acids from 5' Exons

IVVIMRGLPGSGKTHVAKLIR,LLLEDYLAVERHMLQNLF,CCYNERITWQWKDTCCKTYS

Amino Acids from 3' Exons

VMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFE,WNMNMKLRWRRLTAPACSKLSKRLWMMAFFPSSSWMPSMTELGILTSFGVQQKPRDL,NGIISDGGDLPHQHVQNFQKDSGWLFSLHHPGCHQQSAFPVLECSKNQGI