McDonnell Genome Institute

Washington University

CircRNA

chr14|74713484|74716099|+|FCF1|ENST00000553673.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

14

Peptide

LDLVQSMMDCLYAKWEAK

Amino Acids from 5' Exons

GKQKKTRKYATMKRMLSLRDQR,GSKRKQGSMRPSECLVSEIRG,EAKENKEVCDHEANASQRSEA

Amino Acids from 3' Exons

DLFPMNMDKRVYSKQSQADFFFVFVNTRVSMIFLCSCFLFPSVPNTLPAYFSNIIHSWAHLTTSSLIPTLSTFPKPNWTCSQWTVCMPS,IYFQTWTKEFTANSPKQTSFLFLLILGYQCKFFFVLVFFFLQSPTPFLLIFPIYTAGPTLPHPRYQLYQLFHKSQTGLSAVNDGLSVCQ,FISNEHGQKSLQQTVPSRLLFCFCYGINVNFSLFLFSFSFSPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAK