McDonnell Genome Institute

Washington University

CircRNA

chr14|73103191|73112250|+|RBM25|ENST00000261973.11

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

19

Peptide

IIEYIGEEEATLVDFVCSKK

Amino Acids from 5' Exons

KLEEEKGKKEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRS,NWKKRKAKRKKKDRKLRKNGEKERGSVKGNEKGENGNEKGKENVNEKRRKNGSGNENGIGTVTGQKRETEIGIEREIVTGIEKGAQIVIRIAVDQ,TGRRERQKGKRKTGNERTERKREGAKGTRKARTGTRKGKRTTRKGERTGAGTRTGGPPDKRERPRSGSRERSPGRKELRSGSQSIK

Amino Acids from 3' Exons

ILMERRIRPWINKKIIEYIGEEEATLVDFVCSK,YWNVELDHGLIRKSNIVKKKLHLILFVL,TDGTSNTMDENHRIYRRRSYISFCLF