McDonnell Genome Institute

Washington University

CircRNA

chr14|73103191|73111155|+|RBM25|ENST00000261973.11

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9317

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

IGLSLKLETGR

Amino Acids from 5' Exons

KLEEEKGKKEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRS,NWKKRKAKRKKKDRKLRKNGEKERGSVKGNEKGENGNEKGKENVNEKRRKNGSGNENGIGTVTGQKRETEIGIEREIVTGIEKGAQIVIRIAVDQ,TGRRERQKGKRKTGNERTERKREGAKGTRKARTGTRKGKRTTRKGERTGAGTRTGGPPDKRERPRSGSRERSPGRKELRSGSQSIK

Amino Acids from 3' Exons

MEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEPMEEEEEPEQKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKL,WNKRLRGAGSHKSKSQNQKRRKKKSKKKKKNEKNPWKRKRSQSKSLVNLLGPSALLHLFPLPVAMQHLTLLGMSLPVVLLFLMKTHQINSNLRSIGQKDVLNW,GTRGEAQAATNKARARIRRGGRRKARKRRKTRRTHGRGRGARAKALSETYSEAHQLCSICFLCQWQCNTHSWGVSLWYYYSSKLTRSTATGAAKNRTKST