McDonnell Genome Institute

Washington University

CircRNA

chr14|73077368|73088161|+|RBM25|ENST00000261973.11

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9861

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

ASNGVLVPTVSMVGK

Amino Acids from 5' Exons

VLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLA,SYPLCLWLESIWAQERIIQARLKKMMKIVVLLPLFLLATFPRKLQTCLDNS,LSTHCVYGWKAFGRKKGSSRLKGRKKLWSYYHCFCWQHFRESFRHAYKTTLS

Amino Acids from 3' Exons

PSDSVSTRSQNLPSVHSDYYMTCKLERKSYSLKLMQRQRHSWMNGKQRRKLLM,LRILVQGARIYPPCTQIITPANWREKATRSCKDKGTAGMESKEESFW,FGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASNG