McDonnell Genome Institute

Washington University

CircRNA

chr14|72352094|72518537|+|RGS6|ENST00000355512.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9725

55

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

7

Peptide

YTFEDAQIEDIITK

Amino Acids from 5' Exons

IEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVT,LKTSLQRCKMTRQGVCPSEQSRAFSPKSPVSSQ,RHHYKDARQDRGCAHQNSQELSLQNPQCRH

Amino Acids from 3' Exons

VLAGCPRSETTPTGCGQEGRRNLARVSGSRGSKCNQPGFSQLDNQSKCQRWREIYIRRP,FWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQ,SGWLSKILRNNPYRMWPRGKKSGKSFWLQGLQVQSTWILTAMRPVKMSKMEGDIHLKTP