McDonnell Genome Institute

Washington University

CircRNA

chr14|70946914|70978648|+|PCNX|ENST00000304743.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9128

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

IPMQMNLLPK

Amino Acids from 5' Exons

ALPSTMIIVAVYCPVIAAVFIVLKMVNYRLHRALDAGEVVDRTANEFTDQRTKAEQGNCSTRRKDSNGP,PFLLPLQFIVLLLFSLFRWSTIDYTEHLMLEKLIGLQMSSRISEPKLNKATVQPGEKTAMDR,PSFYHDYSSSLLSCDSCCFHCSEDGQLSTTQSTCWRSCRDCKVHGSANQSTRQLFNQEKRQQWTE

Amino Acids from 3' Exons

IWQLIGSSFVLSPMTPSSLFSLPYPLVDRTCQGTSVTKTCQVITTTTMLISLCPAPVTQKLLLYLYTHTLIEKTTGREVYHGLLALLWLFQTLHMIFPFISKDVDIQLVSNLPSLFLDPKNPWWKILVYLGNFSLLVTKSILLSHPQKVGRANLKQRKAWTAGAAHGVVGQQKATAVERTGTLTVLSAAIKVSRPAQLTRASCQSMRSLLKQEQKVGGRKSAVQAQRRRIAVPVTKGLAVKRLLWKRVPTVGFTRPRTPPPLMRCTTREVSAPLHLKKPIKIPMQMNLLPKGTDHLGTLQKTKKRRVISQLFLWIPKCVKMLVESKRKGMFDLNLLASIGQLLPTSQAGDAQEKNGLAVLIQAGIGTMFAFEVFLVPSHTVLYFVMTKTLVIRVTVEHQVFSLLTSSAVIALLAPLLIPVSLLRADTVLRPNTLIKKGAQTLNTHTKLIWFLKEPAKSVQHDGLLAQIVPRLVPECAWTVAQHVMTQTGWHLKVSPPLQNQILRPKRERCMSYLYDGLPSRQSLDLGIACQTRLHFLKGKSKMQSVE,FGSSEALSSCLQLLHLYSAFLILLWTGLAKGLQQSEPAKSPPPPCSVSVQRLHRSSFSCTFTLTLLKRPPAARCTTDFLCCGFSRHFTEFSPLSAKTWIRSSVRIFQASFWIQRILGGKFWFIWGISACWLENQYFSATHKKWEEQTFESREKHGQLEEPEHTEWVNRKLLQWNGPGHQYCQQLKADQLNSHREHPVRAGVSSRNKKWEEERVLCRPRGEELCQQKDQKDCYGSEYQQWGSRGQGPHPLDAQPERSQHLCIRSQKSPCKIYFPRGQTTWEHCRKQRREEVSCFCGFQSARCWWKAKGRGCSTIFRNPSDSFCPQVRQETHRKKTGQFFKPAGLCLLSRCFWYQATQCYILSRRLSELESIKCSVCSPVQQLFHHFSFLSVSGQIQCSKDQTHSRKGHRLTHTQSSFGSRNQQKACNTTDFHKCQDSCPSVEPGQWHSSMFELKQVNGTKYKALNHFKIRSGQRGRGARAIFIRTGFPVRDSHSIELAKPGCISRGRARCSQW,LAADRKLFRLVSNDSFISIQPSLSSCGQDLPRDFSDKVNLPSHNHHHHVDQSLSSACDTEVASLVPLHSHSYRKDHRPRGVPRTSSSAVAFPDTSLNDFPLYQQRRGLDPVSELESSKPLSGSKESLVENSGLSGEFQLAGDLKINTSQPPTKSGKSKPLKAEKSMDSLRSLSTRSSGSTESYCSGTDRDTNSTVSSYKSEQTSSTHIESILSEHEESPKAGTKSGRKKECCAGPEEKNSCASDKRTSSEKIAMEASTNSGVHEAKDPTPSDEMHNQRGLSTSASEEANKNPHANEFTSQGDRPPGNTAENKEEKSDKSAVSVDSKVRKDVGGKQKEGDVRPKSSSVIHRTASAHKSGRRRTGKKRASSFDSSRHRDYVCFRGVSGTKPHSAIFCHDEDSSDQSDLSRASSVQSAHQFSSDSSSSTTSHSCQSPEGRYSALKTKHTHKERGTDSEHTHKAHLVPEGTSKKRATRRTSSTNSAKTRARVLSLDSGTVACLNDSNRLMAPESIKPLTTSKSDLEAKEGEVLDELSLLGRASQLETVTRSRNSLPNQVAFPEGEEQDAVSG