McDonnell Genome Institute

Washington University

CircRNA

chr14|69091673|69091887|-|DCAF5|ENST00000341516.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.952

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

LQEIVTSSLLR

Amino Acids from 5' Exons

FSPALWWKPVPPKCHECTIQQQRDPAPGPEATPAPCALHPFPPACVSVQSGLLQLMHHEKLLFCRRSP,SLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQ,LSCAMVETCPSKVPVYDSTATGPSSWPGDACPLCSMTSIPACLCFSLTIRVTSTHAPKAAVLQEIVT

Amino Acids from 3' Exons

FSPALWWKPVPPKCHECTIQQQRDPAPGPEATPAPCALHPFPPACVSVQSGLLQLMHHEKLLFCRRSP,SLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQ,LSCAMVETCPSKVPVYDSTATGPSSWPGDACPLCSMTSIPACLCFSLTIRVTSTHAPKAAVLQEIVT