McDonnell Genome Institute

Washington University

CircRNA

chr14|68884167|68925672|-|ACTN1|ENST00000193403.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

28

12

Peptide

AAPFNNWMEGAMEDLQDTFIVHTIEEIQTFTAWCNSHLRK

Amino Acids from 5' Exons

RTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQ,GPRNCWRPLTSCTWSMPSGLHPSTTGWRGPWRTCRTPSLCTPLRRS,DRETAGDHPAVLGVCQAGCTLQQLDGGGHGGPAGHLHCAHHGDP

Amino Acids from 3' Exons

TFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVIS,HSRHGVTPTSGRRGHRSRTSKRTSGMASSCCCWRSSQ,IHGMVLPPPEGGDTDREHRRGLPGWPEAHAAAGGHL