McDonnell Genome Institute

Washington University

CircRNA

chr14|68884167|68893747|-|ACTN1|ENST00000193403.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

28

10

Peptide

AAPFNNWMEGAMEDLQDTFIVHTIEEIQAETAANRICK

Amino Acids from 5' Exons

RTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQ,GPRNCWRPLTSCTWSMPSGLHPSTTGWRGPWRTCRTPSLCTPLRRS,DRETAGDHPAVLGVCQAGCTLQQLDGGGHGGPAGHLHCAHHGDP

Amino Acids from 3' Exons

AETAANRICKVLAVNQENEQLMEDYEKLASD,RRQQPIASARCWPSTRRTSSLWKTTRSWPV,GDSSQSHLQGVGRQPGERAAYGRLREAGQ