McDonnell Genome Institute

Washington University

CircRNA

chr14|68878988|68892283|-|ACTN1|ENST00000193403.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9303

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

7

Peptide

ACLISLGYDIGNDPQLLEWIRR

Amino Acids from 5' Exons

DHSGTLGPEEFKACLISLGYDIGNDPQ,ITPAHWVPRSSKPASSAWVMILATTP,SLRHTGSRGVQSLPHQLGLYWQRPP

Amino Acids from 3' Exons

LLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVS,CWSGSAAQSRGWRTGCPRTPCMPCNRSWRTSGTTGACTSRPRCRRSASWRSTSTRCRPSCGSATGLPSCPLRAGWS,VGVDPPHNPVAGEPGAREHHACHATEAGGLPGLPAPAQAAQGAGEVPAGDQLQHAADQAAAQQPACLHALGQDGL