McDonnell Genome Institute

Washington University

CircRNA

chr14|67887020|67887204|+|RAD51B|ENST00000471583.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9642

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

11

Peptide

SFQSQIESLEEEIISK

Amino Acids from 5' Exons

DIFGRRNYLKRNTCDSLCCFCGQKGVCTTSRQSQRKKQVLGKRGILLEVFGGVFNP,IESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIP,LNLWKKKLSQKELNLFLTLLLLWSERSLMHNFKAISKKETSSWQERHPPSIWLRSFQS

Amino Acids from 3' Exons

DIFGRRNYLKRNTCDSLCCFCGQKGVCTTSRQSQRKKQVLGKRGILLEVFGGVFNP,IESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIP,LNLWKKKLSQKELNLFLTLLLLWSERSLMHNFKAISKKETSSWQERHPPSIWLRSFQS