McDonnell Genome Institute

Washington University

CircRNA

chr14|67835079|67887204|+|RAD51B|ENST00000471583.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9397

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

YLAEEFSIPAYGIK

Amino Acids from 5' Exons

AYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTE,LMGKHKGLLISHQHSYLLPFLLWTKPCMVVWLVDPSQ,LWDKSTKVCFLTSILIYYPFCFGRSPAWWCGLWIPHR

Amino Acids from 3' Exons

DIFGRRNYLKRNTCDSLCCFCGQKGVCTTSRQSQRKKQVLGKRGILLEVFGGVFNP,IESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIP,LNLWKKKLSQKELNLFLTLLLLWSERSLMHNFKAISKKETSSWQERHPPSIWLRSFQS