McDonnell Genome Institute

Washington University

CircRNA

chr14|67761365|67772210|-|ZFYVE26|ENST00000347230.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9801

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

VSPVYIPLV

Amino Acids from 5' Exons

QDDDYFATLRELEATLRTQSLSLAVIPEGKIMNNTYYQECLFYLHNYSTNLAIISFYVRHSCLREALLHLLNK,KMTITLPPGNWKLPFGRRAFLWQFLKGKSTTPTTRNASSTCTTIAPTWPSSASTGTAACGKLFCTFST,RRLLCHPEGTGSYPSDAEPFSGSDSRENHEQHLLPGMPLLPAQLHQPGHHQLLREAQLPAGSSSAPSQQ

Amino Acids from 3' Exons

VSPVYIPLVGKGVSHQPSPHRNLCPQRHPLPGTSGYRMRLRVSAWSAAGSTSP,YLQYTFPSKGKEFPTNPALTGICAPSDTPCQAPVGTGDEYLHGLLQGALHH,ISSIHSPSLRERSFPPTQPSQEFVPPATPPARHQWVPDETESICMVCCREHFTM