McDonnell Genome Institute

Washington University

CircRNA

chr14|67752343|67766447|-|ZFYVE26|ENST00000347230.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9866

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

15

Peptide

IPPQAPSASLCIAILNLHR

Amino Acids from 5' Exons

DFQLDAAMTYCRAARQLVEKEKYSEIQQLLKCVSESGMAAKSDGDTILLNCLEAFKRIPPQ,TSSWMLPPTAELPASWWRKRSTVRSSNCSNVSVSQAWQPKVTGTPSSSTAWKRSREFRP,LPAGCCHDLLQSCPPVGGEREVQDPATAQMCQVRHGSQKRGHHPPQLPGSVQENSAP

Amino Acids from 3' Exons

APSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLLTDIMKQLLFSAKMMFVKAGQSQDLALCD,PPAPPCALPSICTGTALPVVTSLSTAAGSPRASPTQRWMPGCSRTSSSCCSAPRCSSKPARAKTWLFVT,PQRLLVHCHPESAPGQHCLWSPADALLQALQGPHQPRGGCRAAHGHHEAAAVQRQDDVRQSRPEPRLGSLQ