McDonnell Genome Institute

Washington University

CircRNA

chr14|67279249|67302571|+|MPP5|ENST00000555925.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9746

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

DVNEVFDLLR

Amino Acids from 5' Exons

RNIRSTERWLLTALEIWAPGCQYVEVHSWSVFGNNRRTGVGERKKGKSKNLTLILPDLRNPKFLQRPEITLCLIQRKELSKVLIMLKY,GTSEAPRDGCLPWRFGHQDDANTSKCTVGAYSATTGGHEAERGRREKARTPFFHETETSPNSSKDRNRPYVYRGRNCLRKSSLCCENI,EHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKIL

Amino Acids from 3' Exons

GATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLL,VLQFVMKWTLSSLAGKGVLQRKVVCCMKEMKFRLMALKFGGKMSMRFLTC,CYSSNGLCHHPDSKRGCCREKWSVARRSSRDWHNSGERCQGFLV