McDonnell Genome Institute

Washington University

CircRNA

chr14|64162071|64165410|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

IWIDFTNRK

Amino Acids from 5' Exons

VDSGEPSHCRPVAEGPESAPALEGLQCSWSCRKAEAAGSKVSTARKHQHVWKQPGRDPAPSPAGHK,WTQVNQAIADQLQKAQSLLQLWKAYSNAHGEAAARLKQQEAKFQQLANISMSGNNLAEILPPALQDIK,GLRTKPLQTSCRRPRVCSSSGRPIAMLMVKLPQGSSRKQSFNSSQTSACLETTWQRSCPQPCRT

Amino Acids from 3' Exons

FVLSQFKDFGVRLESLKGLIMHEEENLDRLHQQEKENPDSFL,LFSHSLRILESGWNLKVLLCMKKRIWIDFTNRKKKILTHS,CSLTVGFWSPAGIFKRSYYARREFGTSPTGKRKSLIP