McDonnell Genome Institute

Washington University

CircRNA

chr14|64141941|64152716|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9107

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

RSSVLTQLQMEK

Amino Acids from 5' Exons

LQMEKLPSRKAITEMISWMNNVEHQTSDEDSVHSPSSASQVKHLLQKHK,FKWRNCRLVKQSQKLAGTMWSIKLQMKTPCIHQVLHLKLNIFFRST,SNGEIAVSSNHRNDLDEQCGASNFRRLRAFTKFCISSTSSSEAQ

Amino Acids from 3' Exons

DIENQLAIKSKALDELKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQ,IKINLQLNPKHMSNKVILWRVGQCHCKIQHPELMSYFKREAVFSL,YRKSTCNIQSTRVETKLSDFGEWGSAIVRRYSIPNVISKEKQCSHS