McDonnell Genome Institute

Washington University

CircRNA

chr14|64119426|64132438|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.914

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

6

Peptide

LQSLLQAMLTEIEHK

Amino Acids from 5' Exons

AMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLKTVKCNLEKVQMMLQEKHSEDQ,LCQRLSTRLPFCRLAKIRAWEIMEPLNMRLKRFPNKQSAIKKSRCFRRSTVKI,YANRDAQGCLSVRDLQRSGPGRWSHSTGSAFPETENSEVQFRKSPDDASGEAQRS

Amino Acids from 3' Exons

VFFQKLVADMLLIQAYSAKILPSLLQNRETFWAEQVTEVKILEEKSRQCGMKLQSLLQ,FFSRSLLLTCCSKHTLPKYFLLYCKTERHFGQNKQKLKYKKSHANVVSCRVCC,FFPEACCHVVDPSILCQNTSFFIAKQRDILGRTSNRSNTRRKVTPMWYEAAEFVA