McDonnell Genome Institute

Washington University

CircRNA

chr14|64073967|64078606|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9417

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

MGFIMLK

Amino Acids from 5' Exons

ASSESSEKRIGADNPRKTFLHKRDNCFEEFLSTDHNFIPKYGIPGSPRKVRTI,LLQKVQKNKELVQTEIQERHSFTKEIIALKNFFQQTTTSFQNMAFQDHPEKSEQFE,FFRKFRKIKNWCRLKSKKDIPSQKRLLRISFNRPQLHSKIWHSRITQKSQNNL

Amino Acids from 3' Exons

ISNEVLKSSPSYAMRRKIEEINNGLHNVEKMLQQKSKNIEKAQEIQK,LAMKSKAHHHMQGEKKKLTMGFIMLKRCCSRKAKILRKLKKFK,QSLKKLTIICNEEKNRRNQWASCKDVAAEKQKYESSRNSK