McDonnell Genome Institute

Washington University

CircRNA

chr14|64024256|64053657|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9839

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

TDFLTLEGR

Amino Acids from 5' Exons

DFLTLEGRNSKIKQVDSVLKHVKKHLPKAHVKELISWLVGQEFELEKMESICQARAKELEDSLQQLL,ISLLKEETVKSRWTAYSMRSICPKHMRSLSVGSWVRNSNKKWSPYARLEQRSLKTPCSSY,FLDSRKKQNKAGGQRTEACEEASAQSTCEGAYQLARGSGIRIRKNGVHMPGSSKGARLLAAATE

Amino Acids from 3' Exons

RTTGQCNVSGQNKIHSIHRKRERFFRQLENQMGEFIKPRDHGEIVGKPDATTWLGTSGTADSKEVFSAGSGIIYNPHEGTGHDFSATAAATSTVKAEVSRRTGREPKHDCLDHPPGYQAWIFCFKGASTSDEEDLGRKRKEEFGGWNKLEETMGNIGAITLRSRKSDEVHKEQDERDYLMGQEFVGTSLHSPSPRHSFTDQKVQSDTWHSSAAVCGIVGRGQRGSPYNLGQFKYPRGLTESIPNAGFKINSKITAIRIVGRKKQFFCYNKEVSTYGSRKNTDNSQGGDSCHGSTKTSPCYFGGISEGIARNQWNLNTSSGANKHLGAECVKIISGRSVEKSDDQQNTKIHSEYMSGTQDKVLQTIPKNISASGGGQYTAQTITSRSKRCRGDLSRQTHRYVLHLTGIETKSVLYWTKLGFFTTPITNPSIKRKGTRKNAVGHIGRTWQISGIIKNESYFANENDSSTKSSLSGKQTAQCPNFKSENESQVFMDNKEIKKDLLIQGERNTTNKAECRRKVIQSSPKHGIRTLTKRIGKELSGQTRNFLTCFKSDKISITAAITYKFGNTYSKKGQLSISGASLGRNVYSCDCYETKRRKLFSECGDKTTVRSSDAAHKHFAH,GPLDSVTYLDKIKKFIASIEKEKDSLGNLKIKWENLSNHVTDMDKKLLESQIKQLEHGWEQVEQQIQKKYSQQVVEYDEFTTLMNKVQDTEISLQQQQQHLQLRLKSPEERAGNQSMIALTTDLQATKHGFSVLKGQAELQMKRIWGEKEKKNLEDGINNLKKQWETLEPLHLEAENQIKKCDIRNKMKETILWAKNLLGELNPSIPLLPDDILSQIRKCKVTHDGILARQQSVESLAEEVKDKVPSLTTYEGSDLNNTLEDLRNQYQMLVLKSTQRSQQLEFKLEERSNFFAIIRKFQLMVQESETLIIPRVETAATEAELKHHHVTLEASQKELQEIDSGISTHLQELTNIYEELNVFERLFLEDQLKNLKIRTNRIQRFIQNTCNEVEHKIKFCRQFHEKTSALQEEADSIQRNELLLNQEVNKGVKEEIYNLKDRLTAIKCCILQVLKLKKVFDYIGLNWDFSQLDQLQTQVFEKEKELEEKIKQLDTFEEEHGKYQALLSKMRAIDLQIKKMTEVVLKAPDSSPESRRLNAQILSQRIEKAKCLCDEIIKKLNENKTFDDSFKEKEILQIKLNAEENDKLYKVLQNMVLELSPKELDEKNCQDKLETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNCEAFQEQVWAEMCSIKAVTAIEKQREENSSEASDVETKLREFEDLQMQLNTSIDLRT,DHWTVRIWTKLKNSHPKKRKILATKSNGRIYQTTLTWIRNCWKARLSNLNMVGNKWNSRFKRSILSRWNMMNLQPSIRYRTLRFLCNSSSNIYSGSLQKNGQGTKALPPLTSRLPSMDFLFRGKLNFRRGFGEKKKRRIWRMEITRNNGKHWSHYTKQKIRLRSVTGTRKRLSYGPRICWVNLIPPFPFSQMTFFHRSESAKHMMAFLGSSLWNRWLKRSKIRFLALQPMRAVIIIPRTYGINTKCWFNQLKDHSNNLSWKKEAIFLLGSFNLWFKKVKHFPGWRQLPRKLNNITMLLWRHLRRNCKKLTVESQHIFRSQTSMRSMCLKDYFWKISKILRLGPTEYKDSFRIHVMKWNTRSFADNSMKKHQRFRRRLTVYSAMNYYLIKKIKVLKRRSIILKTDSPLLSVASYRYNLKKCLTILDTGIFHNLTNYKPKYLKKKRNLKKKLSSWTHLRKNMANIRHYVKELLICKLRKLKYKLLIALRKADGSMPKFVRELRKPSVYVMRRNMKIRPLMTHSRRKKYYKSMQKKMISYTKFSKTWYNSHQKNWMKRIVRTNKLPYMFIRNLNYSSHYLIWKLNIFKMKRTIVKHFRSKFGQKCVVLKLLLLRNKEKKTLLKRVMWRQNYVSLKIFRCSLTQALICA