McDonnell Genome Institute

Washington University

CircRNA

chr14|64024256|64027793|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9336

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

11

Peptide

HLHESLLQQLQDFLTLEGR

Amino Acids from 5' Exons

DFLTLEGRNSKIKQVDSVLKHVKKHLPKAHVKELISWLVGQEFELEKMESICQARAKELEDSLQQLL,ISLLKEETVKSRWTAYSMRSICPKHMRSLSVGSWVRNSNKKWSPYARLEQRSLKTPCSSY,FLDSRKKQNKAGGQRTEACEEASAQSTCEGAYQLARGSGIRIRKNGVHMPGSSKGARLLAAATE

Amino Acids from 3' Exons

PSRKASTRRREIFTKGGSEINAHRTKEETGSRLCSTTWSAGEESSVKDLEIPQESPRFDILAKGVKISGKLPLGVHKSQLQRALAGNKASTRKSSSTTA,HQEKLLLEGEKYLQSKEDLRLMLIELKKKQEAGFALQHGLQEKKAQLKIYKKFLKKAQDLTSLLKELKSQGNYLLECTKNPSFSEEPWLEIKHLHESLLQQLQ,IKKSFYKERNIYKVRRIDCSNRRNRKQALLYNMVCRRRKLSRFIRNSSRKPKIHPCRSNLRETTSWSALKIPASVKSLGWKSIYTKVFFNNC