McDonnell Genome Institute

Washington University

CircRNA

chr14|63998913|64022028|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

LLNGMIHTEIFLNTTCK

Amino Acids from 5' Exons

VYIQRYSTPPAKQQIQDYFFLRGQEFLSAGTDRST,YDTYRDILEHHLQNNKFRITSDFSSEEDRSSSCLQAKLTDLQ,MIHTEIFLNTTCKTTNSGLLLISLVKRTGVVLVCRLNQIY

Amino Acids from 3' Exons

EIQQQILQQKHSMILLENQIGCLTPELSELKKQYESVSDLFNTKKSVLQDHFSKLLN,RYNSRFYSKNTVYYLRIKVVLLNSLNKSNMKVSVIYLIPKKVFCKITFLSYM,DTTADSTAKTQYDITESNRLSDSTLIEKAIKCQFIYQKKCFARSLFVIE