McDonnell Genome Institute

Washington University

CircRNA

chr14|63963898|63979014|+|SYNE2|ENST00000344113.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9276

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

ESVELLLEDWHGK

Amino Acids from 5' Exons

GKVKDAMGWLTLQKEKLQKLLKDSENDTYFKKYN,ERKMLWAGLCKRKNYRSCRIQRMIPTLKSI,KGERCYGLVNSAKGKTTEVAKGFREYLLKV

Amino Acids from 3' Exons

NQQHFGEKIYSTSRISLLQVLSSWFGRSEIKIGYLEHIWEQRICGIIAGRLA,INNILEKKFILLLEFHYYKCLVLGLVDEVKSKLDIWNIKYGSRESVELLLEDWH,STTFWRKNLFYFNFITTSAFLVWMKNQNWIFGTLNMGAENLWNYCWKTG