McDonnell Genome Institute

Washington University

CircRNA

chr14|61738086|61738373|+|HIF1A|ENST00000323441.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9567

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

LMTSNLR

Amino Acids from 5' Exons

TQKLMTSNLRKYHYIMMCSPHPTKNYRIIWQCLHYPPLKRQSHFEVVLTLHSIKKLHNNQIQSHWNFLLPCPRFRIRHLVLPMEALDKVHL,HRNPATGSTIICNAPLTQRKITEYKFGNVSITHRNAKATSKCPCTQSRSCIKIRTKSRVTGTFFYHAPDSGSDTSFRWKHTKFT,TETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPE

Amino Acids from 3' Exons

TQKLMTSNLRKYHYIMMCSPHPTKNYRIIWQCLHYPPLKRQSHFEVVLTLHSIKKLHNNQIQSHWNFLLPCPRFRIRHLVLPMEALDKVHL,HRNPATGSTIICNAPLTQRKITEYKFGNVSITHRNAKATSKCPCTQSRSCIKIRTKSRVTGTFFYHAPDSGSDTSFRWKHTKFT,TETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPE