McDonnell Genome Institute

Washington University

CircRNA

chr14|61453225|61485656|+|PRKCH|ENST00000332981.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9768

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

ESSIVCK

Amino Acids from 5' Exons

YVKMCIFDVKRTWPLTVGMRWNLPRPWQGWVSNPEIFLQP,MNECAYSMSSERGPLWGKCGGTCQDPGRDGSPTRKYFSNL,CKMNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTS

Amino Acids from 3' Exons

DRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIY,IVCFLWSLMGVTCSTFRSLVVLMKHELASMLQKSFRLSCSSMIKESSI,SSVFCDGVCEWGLDVPHSEVSSFSTSSLLCCRNHFGSHVPPRNHL