McDonnell Genome Institute

Washington University

CircRNA

chr14|61443110|61485656|+|PRKCH|ENST00000332981.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9151

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

4

Peptide

GIIYSYSPERPDLQTFYQEAPK

Amino Acids from 5' Exons

LLSRETGSSNILPGSAKGLCEGESTRSMDTSSWPRIGSPPTALTAGSLS,YSPERPDLQTFYQEAPKGYAKASPPDQWTQVHGHVSEAAHLLLSLQGVYL,TLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFI

Amino Acids from 3' Exons

DRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIY,IVCFLWSLMGVTCSTFRSLVVLMKHELASMLQKSFRLSCSSMIKESSI,SSVFCDGVCEWGLDVPHSEVSSFSTSSLLCCRNHFGSHVPPRNHL