McDonnell Genome Institute

Washington University

CircRNA

chr14|60977513|60979886|-|TRMT5|ENST00000261249.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9238

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

DHQLPFK

Amino Acids from 5' Exons

ARLLTKIQESPQQIKIILTICTEISKWKCYLESRTQ,PGYDQKSRNHLSSKNKYQYVPKFPNGSAIWRAEHDDK,QVMIDKNPGITSAVNKINNIDNMYRNFQMEVLSGEQNMMTK

Amino Acids from 3' Exons

DLMEAIWILRKISETGKPHNIKIVDSSSLDIPDTDAFGSTWYFLIGSKKKILNHARNRNTERDIVFTTFCPRHDKTNSFKDSQHSSASEERNSQIDAIPKKGSIAAPRHKTCDRSGRRKTNHVGSLNIYSFLESRTQCFRAACQSTDLIQFGTNITLVRRNLESCASRSRCNFRVQDWTYCTPKPSRSSAAFQTFN,ILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTMPETETHERETELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQRPGIRRVIEDPEDKESRLIMLDPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHFKSEEILRAVLPEGQDVTSGFSRIGHIAHLNLRDHQLPFKHLI,SYGGHLDSQEDFNWKAIALNQNRFQLGHPHRCFWKHLVFSYWVKEKDSQPCQKQKHMRERLNCFHHLLMSEAQNLIEQLLKRQSTFQCLKGKKSVNCDPKGQHCSAQADVLKIRKIKKVDSCWIPIKYLLMIPLRKQNSVFSSLMSVHRSLNTIWNHMNTLSQKKSELCFLKVKMLQGLAGLDILHTTFEIISCLSNIL